PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_37364.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 104aa    MW: 12037.5 Da    PI: 6.5085
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_37364.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM57.83.9e-184492251
           NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkv 51
                  +pGfrFhPt+eel+ +yL++kv+gk++++ + i++vd+y+++PwdLp ++
  MLOC_37364.2 44 MPGFRFHPTEEELIEFYLRRKVDGKRFNI-DLIASVDLYRYDPWDLPGTA 92
                  79***************************.99**************9433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-184292IPR003441NAC domain
PROSITE profilePS5100519.84943104IPR003441NAC domain
PfamPF023658.7E-84586IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MTRSRPTTTM GGSVPDHHHQ QQQHDGEVDG GQLQHGGEHV ETVMPGFRFH PTEEELIEFY  60
LRRKVDGKRF NIDLIASVDL YRYDPWDLPG TAQRRFHLII IMAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-163092264Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6720691e-146AY672069.1 Hordeum vulgare subsp. vulgare NAC transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571314.29e-30PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9FIW53e-19NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLM0VUG26e-73M0VUG2_HORVD; Uncharacterized protein
STRINGMLOC_37364.19e-53(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.23e-26NAC domain containing protein 35